By the Sequora Research Team · Last reviewed: October 22, 2026
Tesamorelin for sale as a 10mg lyophilized research peptide, supplied with a batch-matched Certificate of Analysis from third-party HPLC and mass spectrometry testing. Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone, GHRH(1-44), and belongs to our GHRH Analogues research class. It is sold strictly for laboratory research.
Tesamorelin 10mg specifications
| Compound | Tesamorelin (N-terminally modified hGHRH(1-44)-NH2) |
|---|---|
| Research class | GHRH analogue |
| Sequence | trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 (one-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2, 44 residues) |
| Molecular formula | C221H366N72O67S |
| Molecular weight | 5135.86 g/mol (free base) |
| CAS number | 218949-48-5 (free base); PubChem CID 16137828 |
| Vial contents | 10 mg, lyophilized (freeze-dried) powder |
| Purity and testing | HPLC purity reported for each batch; identity confirmed by mass spectrometry against the theoretical molecular mass |
| Documentation | Batch-matched Certificate of Analysis (batch number printed on the vial label) |
Formula, molecular weight and CAS number are cross-checked against public chemical databases. See Research Sources & Editorial Standards for how we select and cite sources.
Purity testing and the batch COA
Every batch is tested before release. Reversed-phase HPLC separates the peptide from synthesis-related impurities and reports purity as a percentage of total peak area, with the chromatogram it came from. Mass spectrometry confirms identity by matching the measured mass to the expected mass of the tesamorelin sequence, including the N-terminal trans-3-hexenoyl group.
The COA for your vial carries the same batch number as the label, so the document always matches the material. Scan the batch code on the vial or contact us with the batch number to receive the certificate. You can also request the current batch COA before ordering. Our Quality & Testing page explains each section of the certificate, and the guide How to Read a Peptide COA walks through a full example.
Storage of lyophilized tesamorelin
- Store sealed vials of lyophilized powder frozen (around −20 °C) for long-term storage, or refrigerated (2–8 °C) for short periods.
- Keep vials dry and protected from light, and avoid repeated freeze–thaw cycles.
- Let a cold vial reach room temperature before opening to limit condensation on the powder.
This is general laboratory practice for lyophilized research peptides. Full handling guidance is on Quality & Testing.
Research literature summary
Tesamorelin retains the full 44-residue sequence of human GHRH and adds a trans-3-hexenoyl group to the N-terminal tyrosine. Native GHRH is cleaved in plasma between residues 2 and 3 by dipeptidyl peptidase IV (DPP-IV), and the N-terminal modification was designed to reduce that cleavage (Frohman et al., 1989). The compound acts at the GHRH receptor on pituitary somatotroph cells, the same receptor studied with shorter analogues such as sermorelin.
Tesamorelin has been examined in randomized, placebo-controlled clinical studies that measured endpoints including circulating IGF-1 and imaging-based measures of tissue composition (Falutz et al., 2007; Falutz et al., 2010; Stanley et al., 2014). These references are listed to document the compound’s research history. They are not claims about any use of this product.
For how tesamorelin compares with related compounds, see What Are GHRH Analogues?, Sermorelin vs Tesamorelin vs Ipamorelin and AOD-9604 vs Tesamorelin.
Ordering, payment and shipping
- Payment: Zelle. After you place the order, the confirmation page shows the Zelle details and exact total. See How to pay.
- Processing: orders are dispatched within 2–3 business days after payment is verified.
- Delivery: Standard (5–6 business days), FedEx 2 Day or UPS Next Day Air, chosen at checkout. Details are on our Shipping Policy.
Tesamorelin buying and testing FAQ
Where can I buy tesamorelin peptide for laboratory research?
Sequora supplies Tesamorelin 10mg to researchers in the United States, with a batch-matched COA for every vial. Orders are accepted for laboratory research use only, under our Research Use Policy.
What should I check when choosing where to buy tesamorelin online?
Look for a COA tied to the batch number on your vial, an HPLC chromatogram rather than a purity number alone, mass spectrometry identity confirmation, and listed specifications (sequence, formula, CAS number) that match public databases. Each of these is provided for this product.
What is in a Tesamorelin 10mg vial?
10 mg of tesamorelin as a lyophilized powder in a sealed vial, labelled with its batch number.
Can I see the COA before I order?
Yes. Contact us and we will send the certificate for the batch currently in stock.
How is Tesamorelin 10mg shipped?
Lyophilized vials are packed to protect them from breakage and light and ship within 2–3 business days of payment verification. Tracking is emailed when the order leaves.
Can you advise on how to use tesamorelin?
No. We do not provide dosing, preparation, administration or effect information. Questions of that kind cannot be answered.
References
- Frohman LA, Downs TR, Heimer EP, Felix AM. Dipeptidylpeptidase IV and trypsin-like enzymatic degradation of human growth hormone-releasing hormone in plasma. J Clin Invest. 1989;83(5):1533–1540. doi: 10.1172/JCI114049
- Falutz J, Allas S, Blot K, et al. N Engl J Med. 2007;357(23):2359–2370. PMID: 18057338
- Falutz J, Potvin D, Mamputu JC, et al. J Acquir Immune Defic Syndr. 2010;53(3):311–322. PMID: 20101189
- Stanley TL, Feldpausch MN, Oh J, et al. JAMA. 2014;312(4):380–389. PMID: 25038357
- Tesamorelin, PubChem CID 16137828. National Center for Biotechnology Information. pubchem.ncbi.nlm.nih.gov
For laboratory research use only. Not for human or veterinary use.
