By the Sequora Research Team · Last reviewed: October 22, 2026
Sermorelin peptide for sale as a 10mg lyophilized research vial, supplied with a batch-matched Certificate of Analysis from third-party HPLC and mass spectrometry testing. Sermorelin is the synthetic 1–29 amide fragment of human growth hormone-releasing hormone, GHRH(1-29)-NH2, and belongs to our GHRH Analogues research class. It is sold strictly for laboratory research.
Sermorelin 10mg specifications
| Compound | Sermorelin (hGHRH(1-29)-NH2, also called GRF(1-29) amide) |
|---|---|
| Research class | GHRH analogue |
| Sequence | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (one-letter: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, 29 residues) |
| Molecular formula | C149H246N44O42S |
| Molecular weight | 3357.93 g/mol (free base) |
| CAS number | 86168-78-7 (free base); PubChem CID 16132413 |
| Vial contents | 10 mg, lyophilized (freeze-dried) powder |
| Purity and testing | HPLC purity reported for each batch; identity confirmed by mass spectrometry against the theoretical molecular mass |
| Documentation | Batch-matched Certificate of Analysis (batch number printed on the vial label) |
Formula, molecular weight and CAS number are cross-checked against public chemical databases. See Research Sources & Editorial Standards for how we select and cite sources.
Purity testing and the batch COA
Every batch is tested before release. Reversed-phase HPLC separates the peptide from synthesis-related impurities and reports purity as a percentage of total peak area, with the chromatogram it came from. Mass spectrometry confirms identity by matching the measured mass to the expected mass of the 29-residue amidated sequence.
The COA for your vial carries the same batch number as the label, so the document always matches the material. Scan the batch code on the vial or contact us with the batch number to receive the certificate. You can also request the current batch COA before ordering. Our Quality & Testing page explains each section of the certificate, and How to Read a Peptide COA walks through a full example.
Storage of lyophilized sermorelin
- Store sealed vials of lyophilized powder frozen (around −20 °C) for long-term storage, or refrigerated (2–8 °C) for short periods.
- Keep vials dry and protected from light, and avoid repeated freeze–thaw cycles.
- Let a cold vial reach room temperature before opening to limit condensation on the powder.
This is general laboratory practice for lyophilized research peptides. Full handling guidance is on Quality & Testing.
Research literature summary
Sermorelin corresponds to the first 29 amino acids of human GHRH with a C-terminal amide, the shortest fragment that retains activity at the GHRH receptor on pituitary somatotroph cells. Like native GHRH, the 1–29 amide is cleaved in plasma between residues 2 and 3 by dipeptidyl peptidase IV (DPP-IV), which is the main reason it has been compared with stabilized analogues such as tesamorelin (Frohman et al., 1989).
Sermorelin has a long clinical research history as a diagnostic and investigational agent for assessing pituitary growth hormone secretion, summarized in a 1999 review (Prakash and Goa, 1999). These references are listed to document the compound’s research history. They are not claims about any use of this product.
For how sermorelin compares with related compounds, see What Are GHRH Analogues? and Sermorelin vs Tesamorelin vs Ipamorelin. Researchers comparing the full-length stabilized analogue can also view Tesamorelin 10mg.
Ordering, payment and shipping
- Payment: Zelle. After you place the order, the confirmation page shows the Zelle details and exact total. See How to pay.
- Processing: orders are dispatched within 2–3 business days after payment is verified.
- Delivery: Standard (5–6 business days), FedEx 2 Day or UPS Next Day Air, chosen at checkout. Details are on our Shipping Policy.
Sermorelin buying and testing FAQ
Where can I buy sermorelin online for laboratory research?
Sequora supplies Sermorelin 10mg to researchers in the United States, with a batch-matched COA for every vial. Orders are accepted for laboratory research use only, under our Research Use Policy.
What is in a Sermorelin 10mg vial?
10 mg of sermorelin as a lyophilized powder in a sealed vial, labelled with its batch number.
Can I see the COA before I order?
Yes. Contact us and we will send the certificate for the batch currently in stock.
How is sermorelin different from tesamorelin?
Sermorelin is the 29-residue GHRH fragment. Tesamorelin is the full 44-residue sequence with an N-terminal trans-3-hexenoyl group added for resistance to DPP-IV cleavage. Our comparison guide covers the structural differences.
Can you advise on how to use sermorelin?
No. We do not provide dosing, preparation, administration or effect information. Questions of that kind cannot be answered.
References
- Frohman LA, Downs TR, Heimer EP, Felix AM. Dipeptidylpeptidase IV and trypsin-like enzymatic degradation of human growth hormone-releasing hormone in plasma. J Clin Invest. 1989;83(5):1533–1540. doi: 10.1172/JCI114049
- Prakash A, Goa KL. BioDrugs. 1999;12(2):139–157. doi: 10.2165/00063030-199912020-00007; PMID: 18031173
- Sermorelin, PubChem CID 16132413. National Center for Biotechnology Information. pubchem.ncbi.nlm.nih.gov
For laboratory research use only. Not for human or veterinary use.
